G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, WB |
Reactivities | Drosophila, Mouse |
Immunogen | Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule |
G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, WB |
Reactivities | Drosophila, Mouse |
Immunogen | Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule |
Rabbit Polyclonal Anti-GNAO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL |