Antibodies

View as table Download

G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction

Applications ELISA, IHC, WB
Reactivities Drosophila, Mouse
Immunogen Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule

Rabbit Polyclonal Anti-GNAO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL