Antibodies

Jump to Filters
View as table Download
GTF2H2 Rabbit Polyclonal Antibody
AP20441PU-N

USD 370.00

2 Weeks

GTF2H2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
GTF2H2 Rabbit Polyclonal Antibody
TA330122

USD 310.00

5 Days

Rabbit Polyclonal Anti-GTF2H2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the C terminal of human GTF2H2. Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC