Antibodies

Jump to Filters
View as table Download
DEGS1 Rabbit Polyclonal Antibody
AP05308PU-N

USD 360.00

5 Days

DEGS1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the Human DEGS1 protein
DEGS1 Rabbit Polyclonal Antibody
TA338219

USD 375.00

5 Days

Rabbit Polyclonal Anti-DEGS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEGS1 antibody: synthetic peptide directed towards the N terminal of human DEGS1. Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV
DEGS1 Rabbit Polyclonal Antibody
TA349884

USD 345.00

In Stock

Rabbit Polyclonal Anti-DEGS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DEGS1