Antibodies

Jump to Filters
View as table Download
Doublecortin (DCX) Rabbit Polyclonal Antibody
TA346007

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-DCX Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
Doublecortin (DCX) Mouse Monoclonal Antibody
MO22113-100

USD 380.00

2 Weeks

Doublecortin (DCX) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Doublecortin (DCX) Mouse Monoclonal Antibody
MO22136-100

USD 380.00

2 Weeks

Doublecortin (DCX) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Chicken, Equine, Human, Mouse, Porcine, Primate, Rat
Conjugation Unconjugated
Doublecortin (DCX) Rabbit Polyclonal Antibody
AP06599PU-N

USD 370.00

2 Weeks

Doublecortin (DCX) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 271-320 of Human Doublecortin.