Antibodies

Jump to Filters
View as table Download
EDF1 Rabbit Polyclonal Antibody
TA343423

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the middle region of human EDF1. Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
EDF1 Goat Polyclonal Antibody
TA321034

USD 375.00

5 Days

Goat Polyclonal Anti-EDF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region of NP_003783.1; NP_694880.1 (NKQHSITKNTAKLDR)
EDF1 (2-14) Goat Polyclonal Antibody
AP23969PU-N

USD 440.00

2 Weeks

EDF1 (2-14) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Canine, Chicken, Human, Monkey, Mouse, Porcine, Rat, Xenopus
Immunogen Synthetic peptide from positions 2-14 of human EDF1 (NP_003783.1)