Antibodies

Jump to Filters
View as table Download
MSX2 Mouse Monoclonal Antibody [Clone ID: 1F6]
AM20918PU-N

USD 480.00

2 Weeks

MSX2 mouse monoclonal antibody, clone 1F6

Applications ELISA, IHC, WB
Reactivities Human
MSX2 Rabbit Polyclonal Antibody
TA335829

USD 310.00

5 Days

Rabbit Polyclonal Anti-MSX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MSX2 Antibody: synthetic peptide directed towards the N terminal of human MSX2. Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE