Antibodies

Jump to Filters
View as table Download
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA338502

USD 310.00

5 Days

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
GABA A Receptor alpha 3 (GABRA3) Rabbit Polyclonal Antibody
TA330435

USD 310.00

5 Days

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL