Antibodies

Jump to Filters
View as table Download
NMDAR2A (GRIN2A) (C-term) Rabbit Polyclonal Antibody
AP51953PU-N

USD 450.00

2 Weeks

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.
NMDAR2A (GRIN2A) (Center) Rabbit Polyclonal Antibody
AP51952PU-N

USD 450.00

2 Weeks

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA338510

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA350718

USD 345.00

In Stock

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A