Antibodies

Jump to Filters
View as table Download
NR5A2 Rabbit Polyclonal Antibody
TA332898

USD 275.00

3 Weeks

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2
HNF 4 alpha (HNF4A) (2-15) Goat Polyclonal Antibody
AP22495PU-N

USD 440.00

2 Weeks

HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1)
HNF 4 alpha (HNF4A) Rabbit Polyclonal Antibody
TA324733

USD 450.00

5 Days

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.
HNF 4 alpha (HNF4A) Goat Polyclonal Antibody
TA303011

USD 375.00

In Stock

Goat Polyclonal Antibody against HNF4A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1.
HNF 4 alpha (HNF4A) Rabbit Polyclonal Antibody
TA330637

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV
HNF 4 alpha (HNF4A) (+ gamma) Rabbit Polyclonal Antibody
AP06689PU-N

USD 407.00

2 Weeks

HNF 4 alpha (HNF4A) (+ gamma) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human HNF4α.
HNF4 gamma (HNF4G) Rabbit Polyclonal Antibody
TA316895

USD 425.00

5 Days

HNF4G / HNF4 Gamma Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen HNF4G / HNF4 Gamma antibody was raised against synthetic 16 amino acid peptide from internal region of human HNF4G. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Elephant, Panda, Dog (94%); Bat, Horse, Turkey, Chicken (88%); Rat, Pig, Opossum, Platypus (81%).
NR5A2 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
CF805074

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR5A2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HNF 4 alpha (HNF4A) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
CF806582

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NR5A2 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
TA805074

USD 379.00

In Stock

NR5A2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NR5A2 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
TA805074S

USD 159.00

2 Days

NR5A2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNF 4 alpha (HNF4A) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
TA806582S

USD 159.00

In Stock

HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".