Antibodies

Jump to Filters
View as table Download
PXR (NR1I2) (Center) Rabbit Polyclonal Antibody
AP18142PU-N

USD 450.00

2 Weeks

PXR (NR1I2) (Center) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 100-127 aa selected from the Center region of human NR1I2
PXR (NR1I2) Goat Polyclonal Antibody
TA318336

USD 425.00

In Stock

Anti-NR1I2 Goat Polyclonal Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen NR1I2 / PXR / PAR antibody was raised against synthetic peptide EQFAITLKSYIECNR from an internal region of human NR1I2 / PXR (NP_003880.3; NP_071285.1; NP_148934.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Horse, Pig (87%); Panda, Dog, Rabbit (80%).
PXR (NR1I2) Rabbit Polyclonal Antibody
TA339539

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA