Antibodies

Jump to Filters
View as table Download
NR2E1 Rabbit Polyclonal Antibody
TA329898

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2E1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY