Antibodies

Jump to Filters
View as table Download
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA311724

USD 345.00

In Stock

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.
CYP11B1 Rabbit Polyclonal Antibody
TA342857

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA321053

USD 345.00

In Stock

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA321054

USD 345.00

In Stock

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase
CYP11B1 Rabbit Polyclonal Antibody
TA349847

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP11B1