Antibodies

Jump to Filters
View as table Download
CDC25B Rabbit Polyclonal Antibody
TA346009

USD 475.00

5 Days

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE
CDC25A Rabbit Polyclonal Antibody
TA326970

USD 275.00

3 Weeks

CDC25A Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC25A
CDC25C Rabbit Monoclonal Antibody [Clone ID: E302]
TA303434

USD 534.00

In Stock

Rabbit monoclonal antibody against Cdc25C(E302)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
CDC25A Rabbit Polyclonal Antibody
TA590333

USD 409.00

In Stock

Rabbit Polyclonal Cdc25A Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
CDC25C Rabbit Polyclonal Antibody
TA313158

USD 345.00

In Stock

Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K).
Modifications Phospho-specific
CDC25C Rabbit Polyclonal Antibody
TA323120

USD 345.00

4 Weeks

Anti-CDC25C Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.214~218 (S-P-S-M-P) derived from Human cdc25C.
CDC25A (271-300) Rabbit Polyclonal Antibody
AP22784PU-N

USD 440.00

2 Weeks

CDC25A (271-300) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This Cdc25A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-300 amino acids from the Central region of human Cdc25A.
CDC25A Rabbit Polyclonal Antibody
TA313588

USD 345.00

4 Weeks

Rabbit polyclonal CDC25A (Ser75) antibody(Phospho-specific)

Applications IHC, WB
Reactivities H:S76, M:S74, R:S76
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of Ser75
Modifications Phospho-specific
CDC25A Rabbit Polyclonal Antibody
TA313593

USD 345.00

4 Weeks

Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P).
Modifications Phospho-specific
CDC25A Rabbit Polyclonal Antibody
TA325328

USD 345.00

4 Weeks

Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75.
Modifications Phospho-specific
CDC25B Rabbit Polyclonal Antibody
TA330366

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS
CDC25A Rabbit Polyclonal Antibody
TA350822

USD 345.00

In Stock

Rabbit Polyclonal Anti-CDC25A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC25A
CDC25B Rabbit Polyclonal Antibody
TA350823

USD 345.00

In Stock

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC25B