Antibodies

Jump to Filters
View as table Download
TAF1 Rabbit Polyclonal Antibody
TA314589

USD 345.00

In Stock

Rabbit polyclonal anti-TAF1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAF1.
TAF1 Rabbit Polyclonal Antibody
TA330561

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF1 Antibody

Applications Assay, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE