Antibodies

View as table Download

Rabbit Polyclonal Anti-MAK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAK antibody: synthetic peptide directed towards the C terminal of human MAK. Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MAK mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".