Antibodies

View as table Download

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV

Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG2

PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".