Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA346086

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Glutathione Peroxidase 3 (GPX3) (102-114) Goat Polyclonal Antibody
AP22523PU-N

USD 440.00

2 Weeks

Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from internal region of human GPX3
Glutathione Peroxidase 7 (GPX7) Rabbit Polyclonal Antibody
TA308073

USD 415.00

5 Days

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)