Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against LOX
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Mouse Monoclonal VEGF Antibody (VG76e)
| Applications | IHC, WB |
| Reactivities | Human, Bovine, Porcine, Sheep |
| Conjugation | Unconjugated |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Germany
Japan
United Kingdom
China
