Antibodies

Jump to Filters
View as table Download
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA333165

USD 345.00

3 Weeks

Phospho-AURKA-T288 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T288 of human AURKA
Modifications Phospho-specific
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA329186

USD 375.00

5 Days

Rabbit Polyclonal anti-AURKA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AURKA antibody: synthetic peptide directed towards the C terminal of human AURKA. Synthetic peptide located within the following region: ARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS