Antibodies

Jump to Filters
View as table Download
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 370.00

2 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 424.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
BMP7 Rabbit Polyclonal Antibody
AP20768PU-N

USD 407.00

2 Weeks

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7
BMP7 Rabbit Polyclonal Antibody
TA328272

USD 285.00

5 Days

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7
GDF 5 (GDF5) (C-term) Rabbit Polyclonal Antibody
AP51811PU-N

USD 450.00

2 Weeks

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5
BMP7 Rabbit Polyclonal Antibody
TA330253

USD 310.00

5 Days

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
BMP2 Rabbit Polyclonal Antibody
TA328271

USD 285.00

5 Days

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2