Rabbit polyclonal Myb (Phospho-Ser532) antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD |
Rabbit Polyclonal Anti-MYB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MYB |
Germany
Japan
United Kingdom
China
