Antibodies

Jump to Filters
View as table Download
FOXP2 Goat Polyclonal Antibody
TA302735

USD 375.00

5 Days

Goat Polyclonal Antibody against FOXP2

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-REIEEEPLSEDLE, from the C Terminus of the protein sequence according to NP_055306.1; NP_683696.2; NP_683697.1.
FOXP2 Rabbit Polyclonal Antibody
TA334254

USD 375.00

5 Days

Rabbit Polyclonal Anti-FOXP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
FOXP2 Rabbit Polyclonal Antibody
TA334255

USD 310.00

5 Days

Rabbit Polyclonal Anti-FOXP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
FOXP2 Rabbit Polyclonal Antibody
TA322031

USD 345.00

4 Weeks

Anti-FOXP2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 701-715 amino acids of Human forkhead box P2