Antibodies

Jump to Filters
View as table Download
KAT5 Rabbit Polyclonal Antibody
TA319823

USD 430.00

In Stock

Rabbit Polyclonal KAT5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAT5 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human KAT5.
KAT5 Rabbit Polyclonal Antibody
TA315066

USD 345.00

In Stock

Rabbit polyclonal anti-TIP60 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TIP60.
KAT5 Rabbit Polyclonal Antibody
TA315069

USD 345.00

In Stock

Rabbit polyclonal Tip60 (Ser90) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tip60 around the phosphorylation site of serine 90 (P-G-SP-P-E).
Modifications Phospho-specific
KAT5 Rabbit Polyclonal Antibody
TA343605

USD 375.00

5 Days

Rabbit Polyclonal Anti-HTATIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP. Synthetic peptide located within the following region: EGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWV
KAT5 Rabbit Polyclonal Antibody
TA349528

USD 345.00

In Stock

Rabbit Polyclonal Anti-KAT5 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KAT5