Antibodies

View as table Download

Rabbit Polyclonal Lin28 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Lin28 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human Lin28.

Rabbit polyclonal LIN28A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This LIN28A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-138 amino acids from the Central region of human LIN28A.

Rabbit Polyclonal Anti-LIN28 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIN28 Antibody: synthetic peptide directed towards the N terminal of human LIN28. Synthetic peptide located within the following region: GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRM

Rabbit Polyclonal Anti-LIN28A Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LIN28A