Antibodies

View as table Download

Rabbit Polyclonal MED4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MED4 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human MED4.

Rabbit Polyclonal Anti-MED4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED4 antibody: synthetic peptide directed towards the middle region of human MED4. Synthetic peptide located within the following region: EEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPST

Rabbit Polyclonal Anti-MED4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED4 antibody: synthetic peptide directed towards the C terminal of human MED4. Synthetic peptide located within the following region: APQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSS

Rabbit Polyclonal Anti-MED4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein