Rabbit Polyclonal MED4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MED4 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human MED4. |
Rabbit Polyclonal MED4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MED4 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human MED4. |
Rabbit Polyclonal Anti-MED4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MED4 antibody: synthetic peptide directed towards the middle region of human MED4. Synthetic peptide located within the following region: EEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPST |
Rabbit Polyclonal Anti-MED4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MED4 antibody: synthetic peptide directed towards the C terminal of human MED4. Synthetic peptide located within the following region: APQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSS |
Rabbit Polyclonal Anti-MED4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |