Antibodies

Jump to Filters
View as table Download
MSX1 Rabbit Polyclonal Antibody
TA337041

USD 424.00

5 Days

Rabbit Polyclonal MSX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 50-100 of human HOX7 was used as the immunogen.
MSX1 (N-term) Goat Polyclonal Antibody
GT41015-100

USD 400.00

2 Weeks

MSX1 (N-term) goat polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
MSX1 Rabbit Polyclonal Antibody
TA329262

USD 310.00

5 Days

Rabbit Polyclonal anti-MSX1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSX1 antibody: synthetic peptide directed towards the middle region of human MSX1. Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
MSX1 Goat Polyclonal Antibody
TA305641

USD 375.00

5 Days

Goat Anti-MSX1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TSLPLGVKVEDS-C, from the N Terminus of the protein sequence according to NP_002439.1.