Antibodies

Jump to Filters
View as table Download
FADS1 Rabbit Polyclonal Antibody
TA346476

USD 410.00

5 Days

Rabbit Polyclonal Anti-FADS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the C terminal of human FADS1. Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
FADS1 Mouse Monoclonal Antibody [Clone ID: 2D9]
AM31762PU-N

USD 480.00

2 Weeks

FADS1 mouse monoclonal antibody, clone 2D9, Purified

Applications ELISA, IHC, WB
Reactivities Human
FADS1 Rabbit Polyclonal Antibody
TA349954

USD 345.00

In Stock

Rabbit Polyclonal Anti-FADS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FADS1