Antibodies

View as table Download

Rabbit Polyclonal Anti-ILF3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ILF3 antibody: synthetic peptide directed towards the N terminal of human ILF3. Synthetic peptide located within the following region: ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR

Rabbit Polyclonal Anti-ILF3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ILF3 antibody: synthetic peptide directed towards the N terminal of human ILF3. Synthetic peptide located within the following region: PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Goat Anti-ILF3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKPSYGSGYQSHQGQ, from the internal region of the protein sequence according to NP_036350.2; NP_060090.2.