Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit Polyclonal Anti-UBE2J2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Rabbit Polyclonal Anti-FBXW7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBXW7 |
Germany
Japan
United Kingdom
China
