Antibodies

Jump to Filters
View as table Download
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA337291

USD 375.00

In Stock

Rabbit Polyclonal Anti-ASPH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA339207

USD 310.00

In Stock

Rabbit Polyclonal Anti-ASPH

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE
Aspartate beta hydroxylase (ASPH) (Center) Rabbit Polyclonal Antibody
AP50276PU-N

USD 450.00

2 Weeks

Aspartate beta hydroxylase (ASPH) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 301-331 amino acids from the Central region of human ASPH