USD 480.00
2 Weeks
Claudin 1 (CLDN1) (full length) mouse monoclonal antibody, clone 1C5-D9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
Claudin 1 (CLDN1) (full length) mouse monoclonal antibody, clone 1C5-D9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Immunogen | CLDN1 antibody was raised against a synthetic peptide derived from the C-terminus of human Claudin-1 |
Rabbit polyclonal anti-Claudin 1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 1. |
Rabbit Polyclonal Anti-CLDN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Rabbit anti Claudin 1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from C-terminus of human claudin 1 protein. |
Anti-CLDN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1 |
Anti-CLDN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1 |