Antibodies

Jump to Filters
View as table Download
KLB Rabbit Polyclonal Antibody
TA337557

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-KLB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG