Antibodies

View as table Download

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human, Porcine
Immunogen Porcine Collagen, types 1 and 3 from skin

Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Human
Immunogen Collagen I antibody was raised against human placental collagen Type I.

Collagen I (COL1A1) mouse monoclonal antibody, clone BDI314, Azide Free

Applications ELISA, IHC
Reactivities Human