Antibodies

Jump to Filters
View as table Download
PITX2 Rabbit Polyclonal Antibody
TA339054

USD 310.00

5 Days

Rabbit Polyclonal Anti-PITX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE