Antibodies

Jump to Filters
View as table Download
Acid Phosphatase (ACP1) Rabbit Polyclonal Antibody
TA346376

USD 410.00

5 Days

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP
Acid Phosphatase (ACP1) Rabbit Polyclonal Antibody
TA373205

USD 275.00

3 Weeks

ACP1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human ACP1 (NP_009030.1).
Modifications Unmodified