Antibodies

Jump to Filters
View as table Download
Rab5 (RAB5A) Rabbit Polyclonal Antibody
TA342212

USD 375.00

5 Days

Rabbit polyclonal Anti-RAB5A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS