Antibodies

Jump to Filters
View as table Download
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA372739

USD 380.00

4 Weeks

ONECUT1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ONECUT1
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA343467

USD 375.00

5 Days

Rabbit Polyclonal Anti-ONECUT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA