Rabbit Polyclonal Anti-PPIB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIB antibody: synthetic peptide directed towards the middle region of human PPIB. Synthetic peptide located within the following region: FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC |
Rabbit Polyclonal Anti-PPIB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIB antibody: synthetic peptide directed towards the C terminal of human PPIB. Synthetic peptide located within the following region: VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE |
Rabbit Polyclonal Anti-PPIB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPIB |
PPIB rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPIB |
Germany
Japan
United Kingdom
China
