Antibodies

Jump to Filters
View as table Download
PPME1 Rabbit Polyclonal Antibody
TA345059

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPME1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPME1 antibody: synthetic peptide directed towards the N terminal of human PPME1. Synthetic peptide located within the following region: PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHG
PPME1 Rabbit Polyclonal Antibody
TA312376

USD 345.00

In Stock

Rabbit polyclonal Caspase 10 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 10.