Antibodies

Jump to Filters
View as table Download
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA342651

USD 375.00

5 Days

Rabbit Polyclonal Anti-SSTR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA323284

USD 345.00

In Stock

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA323285

USD 345.00

4 Weeks

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1