Antibodies

Jump to Filters
View as table Download
TAF1 48 (TAF1A) Rabbit Polyclonal Antibody
TA330076

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL