Antibodies

Jump to Filters
View as table Download
SNAIL (SNAI1) Rabbit Polyclonal Antibody
AP20370PU-N

USD 370.00

2 Weeks

SNAIL (SNAI1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from human SNAI 1 around the phosphorylation site of Serine 246.
SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: OTI5E12]
TA500316

USD 379.00

In Stock

Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SNAIL (SNAI1) Rabbit Polyclonal Antibody
TA349439

USD 380.00

In Stock

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SNAI1
SNAIL (SNAI1) Rabbit Polyclonal Antibody
TA332751

USD 275.00

3 Weeks

Rabbit anti-Snail Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Snail
SNAIL (SNAI1) pSer246 Rabbit Polyclonal Antibody
AP20798PU-N

USD 370.00

2 Weeks

SNAIL (SNAI1) pSer246 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
SNAIL (SNAI1) Rabbit Polyclonal Antibody
TA333928

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL
SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: OTI5E12]
CF500316

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: OTI5E12]
TA500316S

USD 159.00

2 Days

Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".