Antibodies

Jump to Filters
View as table Download
YES1 Rabbit Polyclonal Antibody
TA590206

USD 409.00

In Stock

Rabbit Polyclonal Yes1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
YES1 (284-541) Rabbit Polyclonal Antibody
AP23146PU-N

USD 440.00

2 Weeks

YES1 (284-541) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 284 and 541 of Human c-Yes
YES1 Rabbit Polyclonal Antibody
TA358529

USD 360.00

5 Days

YES1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA