Rabbit Polyclonal Anti-SLC1A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2. Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK |
Rabbit Polyclonal Anti-SLC1A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2. Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM |
Anti-SLC1A2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 556-574 amino acids of human solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
Germany
Japan
United Kingdom
China
