Antibodies

Jump to Filters
View as table Download
ABP1 (AOC1) Rabbit Polyclonal Antibody
TA346273

USD 475.00

5 Days

Rabbit Polyclonal Anti-ABP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
ABP1 (AOC1) Rabbit Polyclonal Antibody
TA308835

USD 415.00

In Stock

Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801)