Antibodies

Jump to Filters
View as table Download
C1QB Rabbit Polyclonal Antibody
TA335243

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD