Antibodies

Jump to Filters
View as table Download
C4BPB Rabbit Polyclonal Antibody
TA334285

USD 375.00

5 Days

Rabbit Polyclonal Anti-C4BPB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4BPB antibody: synthetic peptide directed towards the N terminal of human C4BPB. Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV