Antibodies

Jump to Filters
View as table Download
E2F2 (202-252) Rabbit Polyclonal Antibody
AP06731PU-N

USD 370.00

2 Weeks

E2F2 (202-252) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 202-252 of Human E2F-2.
E2F2 Rabbit Polyclonal Antibody
TA343440

USD 375.00

5 Days

Rabbit Polyclonal Anti-E2F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2. Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI