Antibodies

Jump to Filters
View as table Download
GSTM2 Rabbit Polyclonal Antibody
TA346231

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM2 antibody: synthetic peptide directed towards the N terminal of human GSTM2. Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
GSTM2 Mouse Monoclonal Antibody [Clone ID: 1E10]
AM31792PU-N

USD 480.00

2 Weeks

GSTM2 mouse monoclonal antibody, clone 1E10, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse