Antibodies

Jump to Filters
View as table Download
ALAS2 Rabbit Polyclonal Antibody
TA346264

USD 410.00

5 Days

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ